Web Analysis for Sanliurfaevdenevenakliyatfirmalari - sanliurfaevdenevenakliyatfirmalari.com
Şanlıurfa Evden Eve Nakliyat Firmaları, Urfa Evden Eve Taşımacılık Şirketleri
3.33
Rating by CuteStat
sanliurfaevdenevenakliyatfirmalari.com is 6 years 10 months old. It is a domain having com extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, sanliurfaevdenevenakliyatfirmalari.com is SAFE to browse.
PageSpeed Score
100
Siteadvisor Rating
Not Applicable
Traffic Report
| Daily Unique Visitors: | Not Applicable |
| Daily Pageviews: | Not Applicable |
Estimated Valuation
| Income Per Day: | $ 0.15 |
| Estimated Worth: | $ 8.95 |
Search Engine Indexes
| Google Indexed Pages: | Not Applicable |
| Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
| Google Backlinks: | Not Applicable |
| Bing Backlinks: | Not Applicable |
Safety Information
| Google Safe Browsing: | No Risk Issues |
| Siteadvisor Rating: | Not Applicable |
| WOT Trustworthiness: | Not Applicable |
| WOT Child Safety: | Not Applicable |
Website Ranks & Scores
| Alexa Rank: | Not Applicable |
| Domain Authority: | Not Applicable |
Web Server Information
Hosted IP Address:
37.247.107.161
Hosted Country:
TR
Location Latitude:
40.2719Location Longitude:
29.0983Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
| H1 Headings: | 1 | H2 Headings: | 1 |
| H3 Headings: | 1 | H4 Headings: | 1 |
| H5 Headings: | 1 | H6 Headings: | 1 |
| Total IFRAMEs: | Not Applicable | Total Images: | Not Applicable |
| Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
Websites Hosted on Same IP (i.e. 37.247.107.161)
Türkiyenin Haber Bölgesi/Türkiyenin haber bölgesi
Haber sitesi
735,224
$
960.00
Boşanma Davası ve Boşanma Hukuku Hakkında, Her Konuda Boşanma Destek k
Netbosanma sitesi, Boşanma Davası ve Boşanma Hukuku Hakkında Tüm Soruların Cevaplarını içerir
2,335,834
$
240.00
Gokay C | Gokayc's General Blog
Internet, technology, wordpress, wordpress seo plugins, wordpress plugins, webmaster stuffs, seo, general blog.
1,627,372
$
480.00
Online Pasta Sipariş - 0212 424 16 55
Online Pasta Sipariş internet sitemiz Butik Pasta tasarımları ile sizlere özel gün ve davetleriniz için eşsiz güzellikte Pastalar ve lezzetler sunuyor.
Not Applicable
$
8.95
HTTP Header Analysis
HTTP/1.1 200 OK
Date: Thu, 22 Jun 2017 22:18:33 GMT
Server: LiteSpeed
Accept-Ranges: bytes
Connection: close
ETag: "6e2-594ad273-0"
Last-Modified: Wed, 21 Jun 2017 20:09:23 GMT
Content-Type: text/html
Content-Length: 742
Content-Encoding: gzip
Vary: Accept-Encoding
Date: Thu, 22 Jun 2017 22:18:33 GMT
Server: LiteSpeed
Accept-Ranges: bytes
Connection: close
ETag: "6e2-594ad273-0"
Last-Modified: Wed, 21 Jun 2017 20:09:23 GMT
Content-Type: text/html
Content-Length: 742
Content-Encoding: gzip
Vary: Accept-Encoding
Domain Information
| Domain Registrar: |
FBS Inc.
|
|---|---|
| Registration Date: | Jun 21, 2017, 12:00 AM 6 years 10 months 3 weeks ago |
| Last Modified: | Jun 21, 2017, 12:00 AM 6 years 10 months 3 weeks ago |
| Expiration Date: | Jun 21, 2018, 12:00 AM 5 years 10 months 3 weeks ago |
| Domain Status: |
clientTransferProhibited
|
Domain Nameserver Information
| Host | IP Address | Country | |
|---|---|---|---|
| lin25.ozkula.com |
|
37.247.110.3 |
Türkiye
|
| lin26.ozkula.com |
|
37.247.110.3 |
Türkiye
|
DNS Record Analysis
| Host | Type | TTL | Extra |
|---|---|---|---|
| sanliurfaevdenevenakliyatfirmalari.com | A | 14394 |
IP: 37.247.107.161 |
| sanliurfaevdenevenakliyatfirmalari.com | NS | 86399 |
Target: lin26.ozkula.com |
| sanliurfaevdenevenakliyatfirmalari.com | NS | 86399 |
Target: lin25.ozkula.com |
| sanliurfaevdenevenakliyatfirmalari.com | SOA | 86399 |
MNAME: lin25.ozkula.com RNAME: vedatkaracaoglu.gmail.com Serial: 2017062103 Refresh: 3600 Retry: 7200 Expire: 1209600 Minimum TTL: 86400 |
| sanliurfaevdenevenakliyatfirmalari.com | MX | 14399 |
Target: sanliurfaevdenevenakliyatfirmalari.com |
Full WHOIS Lookup
Whois Server Version 2.0
Domain names in the .com and .net domains can now be registered
with many different competing registrars. Go to http://www.internic.net
for detailed information.
Domain Name: SANLIURFAEVDENEVENAKLIYATFIRMALARI.COM
Registrar: FBS INC.
Sponsoring Registrar IANA ID: 1110
Whois Server: whois.isimtescil.net
Referral URL: http://www.isimtescil.net
Name Server: LIN25.OZKULA.COM
Name Server: LIN26.OZKULA.COM
Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Updated Date: 21-jun-2017
Creation Date: 21-jun-2017
Expiration Date: 21-jun-2018
>>> Last update of whois database: Thu, 22 Jun 2017 22:22:32 GMT
Domain names in the .com and .net domains can now be registered
with many different competing registrars. Go to http://www.internic.net
for detailed information.
Domain Name: SANLIURFAEVDENEVENAKLIYATFIRMALARI.COM
Registrar: FBS INC.
Sponsoring Registrar IANA ID: 1110
Whois Server: whois.isimtescil.net
Referral URL: http://www.isimtescil.net
Name Server: LIN25.OZKULA.COM
Name Server: LIN26.OZKULA.COM
Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Updated Date: 21-jun-2017
Creation Date: 21-jun-2017
Expiration Date: 21-jun-2018
>>> Last update of whois database: Thu, 22 Jun 2017 22:22:32 GMT
